Q8HXQ3 |
UniProt ID : |
Q8HXQ3 |
NCBI Taxonomy : |
9580 |
Protein names : |
Superoxide dismutase [Cu-Zn] |
Organism : |
Hylobates lar |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
154 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0031410 | Cellular Component | cytoplasmic vesicle | ISS | GO:0005829 | Cellular Component | cytosol | ISS | GO:0032839 | Cellular Component | dendrite cytoplasm | ISS | GO:0031012 | Cellular Component | extracellular matrix | ISS | GO:0005615 | Cellular Component | extracellular space | ISS | GO:0005739 | Cellular Component | mitochondrion | ISS | GO:0043025 | Cellular Component | neuronal cell body | ISS | GO:0005634 | Cellular Component | nucleus | ISS | GO:0043234 | Cellular Component | protein complex | ISS | GO:0051087 | Molecullar Function | chaperone binding | ISS | GO:0005507 | Molecullar Function | copper ion binding | ISS | GO:0030346 | Molecullar Function | protein phosphatase 2B binding | ISS | GO:0004784 | Molecullar Function | superoxide dismutase activity | ISS | GO:0008270 | Molecullar Function | zinc ion binding | ISS | GO:0000187 | Biological Process | activation of MAPK activity | ISS | GO:0006309 | Biological Process | apoptotic DNA fragmentation | ISS | GO:0060088 | Biological Process | auditory receptor cell stereocilium organization | ISS | GO:0007569 | Biological Process | cell aging | ISS | GO:0006879 | Biological Process | cellular iron ion homeostasis | ISS | GO:0006302 | Biological Process | double-strand break repair | ISS | GO:0007566 | Biological Process | embryo implantation | ISS | GO:0006749 | Biological Process | glutathione metabolic process | ISS | GO:0060047 | Biological Process | heart contraction | ISS | GO:0050665 | Biological Process | hydrogen peroxide biosynthetic process | ISS | GO:0007626 | Biological Process | locomotory behavior | ISS | GO:0046716 | Biological Process | muscle cell cellular homeostasis | ISS | GO:0002262 | Biological Process | myeloid cell homeostasis | ISS | GO:0045541 | Biological Process | negative regulation of cholesterol biosynthetic process | ISS | GO:0043524 | Biological Process | negative regulation of neuron apoptotic process | ISS | GO:0060052 | Biological Process | neurofilament cytoskeleton organization | ISS | GO:0001541 | Biological Process | ovarian follicle development | ISS | GO:0032287 | Biological Process | peripheral nervous system myelin maintenance | ISS | GO:0001819 | Biological Process | positive regulation of cytokine production | ISS | GO:0008217 | Biological Process | regulation of blood pressure | ISS | GO:0051881 | Biological Process | regulation of mitochondrial membrane potential | ISS | GO:0040014 | Biological Process | regulation of multicellular organism growth | ISS | GO:0060087 | Biological Process | relaxation of vascular smooth muscle | ISS | GO:0019430 | Biological Process | removal of superoxide radicals | ISS | GO:0048678 | Biological Process | response to axon injury | ISS | GO:0042493 | Biological Process | response to drug | ISS | GO:0045471 | Biological Process | response to ethanol | ISS | GO:0009408 | Biological Process | response to heat | ISS | GO:0042542 | Biological Process | response to hydrogen peroxide | ISS | GO:0001895 | Biological Process | retina homeostasis | ISS | GO:0007605 | Biological Process | sensory perception of sound | ISS | GO:0007283 | Biological Process | spermatogenesis | ISS | |
Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
SWISS-MODEL Repository : | Q8HXQ3 |
Sequences : |
MAMKAVCVLKGDSPVQGIINFEQKESNGPVKVYGRITGLTEGLHGFHVHQFGDNTQGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVAKVSIEDSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ |
Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. |