Q8GY89
UniProt ID : Q8GY89
NCBI Taxonomy : 3702
Protein names : Sulfiredoxin, chloroplastic/mitochondrial
Organism : Arabidopsis thaliana
Taxonomy : Eukaryota
Subcellular locations :Plastid;Mitochondrion;
Length : 125
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0009507Cellular ComponentchloroplastIDA
GO:0005739Cellular ComponentmitochondrionIDA
GO:0005524Molecullar FunctionATP bindingIEA
GO:0003677Molecullar FunctionDNA bindingIEA
GO:0032542Molecullar Functionsulfiredoxin activityIEA
Catalytic activity :Peroxiredoxin-(S-hydroxy-S-oxocysteine) + ATP + 2 R-SH = peroxiredoxin-(S-hydroxycysteine) + ADP + phosphate + R-S-S-R.
SWISS-MODEL Repository :Q8GY89
Sequences : MANLMMRLPISLRSFSVSASSSNGSPPVIGGSSGGVGPMIVELPLEKIRRPLMRTRSNDQNKVKELMDSIRQIGLQVPIDVIEVDGTYYGFSGCHRYEAHQKLGLPTIRCKIRKGTKETLRHHLR
Function :Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in a peroxiredoxin. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase. Required to switch on the antioxidant pathway to regenerate the oxidative damage. In mitochondrion, catalyzes the retroreduction of the inactive sulfinic form of atypical Prx IIF using thioredoxin as reducing agent.