| Q8GY89 |
| UniProt ID : |
Q8GY89 |
| NCBI Taxonomy : |
3702 |
| Protein names : |
Sulfiredoxin, chloroplastic/mitochondrial |
| Organism : |
Arabidopsis thaliana |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Plastid;Mitochondrion; |
| Length : |
125 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0009507 | Cellular Component | chloroplast | IDA | | GO:0005739 | Cellular Component | mitochondrion | IDA | | GO:0005524 | Molecullar Function | ATP binding | IEA | | GO:0003677 | Molecullar Function | DNA binding | IEA | | GO:0032542 | Molecullar Function | sulfiredoxin activity | IEA | |
| Catalytic activity : | Peroxiredoxin-(S-hydroxy-S-oxocysteine) + ATP + 2 R-SH = peroxiredoxin-(S-hydroxycysteine) + ADP + phosphate + R-S-S-R. |
| SWISS-MODEL Repository : | Q8GY89 |
| Sequences : |
MANLMMRLPISLRSFSVSASSSNGSPPVIGGSSGGVGPMIVELPLEKIRRPLMRTRSNDQNKVKELMDSIRQIGLQVPIDVIEVDGTYYGFSGCHRYEAHQKLGLPTIRCKIRKGTKETLRHHLR |
| Function : | Contributes to oxidative stress resistance by reducing cysteine-sulfinic acid formed under exposure to oxidants in a peroxiredoxin. May catalyze the reduction in a multi-step process by acting both as a specific phosphotransferase and a thioltransferase. Required to switch on the antioxidant pathway to regenerate the oxidative damage. In mitochondrion, catalyzes the retroreduction of the inactive sulfinic form of atypical Prx IIF using thioredoxin as reducing agent. |