| D0EYG3 |
| UniProt ID : |
D0EYG3 |
| NCBI Taxonomy : |
9031 |
| Protein names : |
Selenoprotein W |
| Organism : |
Gallus gallus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
85 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | IEA | | GO:0016209 | Molecullar Function | antioxidant activity | IEA | | GO:0008430 | Molecullar Function | selenium binding | IEA | | GO:0045454 | Biological Process | cell redox homeostasis | IEA | |
|
| Sequences : |
MPLRVTVLYCGAUGYKPKYERLRAELEKRFPGALEMRGQGTQEVTGWFEVTVGSRLVHSKKNGDGFVDTDAKLQRIVAAIQAALP |
| Function : | Plays a role as a glutathione (GSH)-dependent antioxidant. May be involved in a redox-related process. May play a role in the myopathies of selenium deficiency (By similarity). |