| Q8CXF3 |
| UniProt ID : |
Q8CXF3 |
| NCBI Taxonomy : |
221109 |
| Protein names : |
Thiol-disulfide oxidoreductase ResA |
| Organism : |
Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) |
| Taxonomy : |
Bacteria |
| Subcellular locations : | Cell membrane; |
| Length : |
192 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0016021 | Cellular Component | integral to membrane | IEA | | GO:0005886 | Cellular Component | plasma membrane | IEA | | GO:0016209 | Molecullar Function | antioxidant activity | IEA | | GO:0015036 | Molecullar Function | disulfide oxidoreductase activity | IEA | | GO:0045454 | Biological Process | cell redox homeostasis | IEA | | GO:0017004 | Biological Process | cytochrome complex assembly | IEA | |
| Sequences : |
MDIQQNKTNKQKKKRNRFIFRSSILLILVAAVVFAIVSNMKDDNKIYRVGDAAPDFQLKQISEEVDQSTVQLSDLEGKGVMLNFWATWCDPCKAEMPYMQDLYAEYKEKGVEIVAVSLDGTELVVDQFIDEYDLTFPVPHDKNGEVKDLYKIGPMPTTYFIKPNGEIEEIVQGALTLDRLEGYLNDIAPQQN |
| Function : | Thiol-disulfide oxidoreductase which is required in disulfide reduction during c-type cytochrome synthesis. May accept reducing equivalents from CcdA, leading to breakage of disulfide bonds in apocytochrome c; following this reduction heme can be covalently attached (By similarity). |