show

Q7BHK8

UniProt ID :

Q7BHK8

NCBI Taxonomy :

1773

Protein names :

Alkyl hydroperoxide reductase subunit C

Organism :

Mycobacterium tuberculosis

Taxonomy :

Bacteria

Length :

195

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005618	Cellular Component	cell wall	IDA
GO:0005829	Cellular Component	cytosol	TAS
GO:0005886	Cellular Component	plasma membrane	IDA
GO:0008785	Molecullar Function	alkyl hydroperoxide reductase activity	IDA
GO:0032843	Molecullar Function	hydroperoxide reductase activity	IDA
GO:0004601	Molecullar Function	peroxidase activity	IDA
GO:0051920	Molecullar Function	peroxiredoxin activity	IDA
GO:0045454	Biological Process	cell redox homeostasis	IDA
GO:0052060	Biological Process	evasion or tolerance by symbiont of host-produced nitric oxide	TAS
GO:0052059	Biological Process	evasion or tolerance by symbiont of host-produced reactive oxygen species	TAS
GO:0051260	Biological Process	protein homooligomerization	IPI
GO:0051409	Biological Process	response to nitrosative stress	IMP

Catalytic activity :

2 R'-SH + ROOH = R'-S-S-R' + H₂O + ROH.

SWISS-MODEL Repository :

Q7BHK8

Sequences :

MPLLTIGDQFPAYQLTALIGGDLSKVDAKQPGDYFTTITSDEHPGKWRVVFFWPKDFTFVCPTEIAAFSKLNDEFEDRDAQILGVSIDSEFAHFQWRAQHNDLKTLPFPMLSDIKRELSQAAGVLNADGVADRVTFIVDPNNEIQFVSATAGSVGRNVDEVLRVLDALQSDELCACNWRKGDPTLDAGELLKASA

Function :

Together with AhpD, DlaT and Lpd, constitutes an NADH-dependent peroxidase active against hydrogen and alkyl peroxides as well as serving as a peroxynitrite reductase, thus protecting the bacterium against reactive nitrogen intermediates and oxidative stress generated by the host immune system. Does not however seem to play a role in detoxification of isoniazid.