| Q75SY5 |
| UniProt ID : |
Q75SY5 |
| NCBI Taxonomy : |
55190 |
| Protein names : |
Peroxiredoxin Q, chloroplastic |
| Organism : |
Gentiana triflora |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Plastid; |
| Length : |
217 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0009534 | Cellular Component | chloroplast thylakoid | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| Sequences : |
MAAICLPVAKHSFPSLLNTQTPKPLFSQNLHTIPLSSQSQICGLKFLISSPSSLPPPPSYSARISVFAKVSKGSVPPQFTLKDQDGKNVSLTEFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVIGISGDDPSSHKAFAKKYRLPYTLLSDEGNKIRREWGVPADLFGTLPGRQTYVLDKNGTVQLIYNNQFQPEKHIDETLKFLQSA |
| Function : | Reduces hydrogen peroxide with reducing equivalents provided through the thioredoxin system. Involved in both resistance against fungal disease and oxidative stress. |