Q73B22 |
UniProt ID : |
Q73B22 |
NCBI Taxonomy : |
222523 |
Protein names : |
Thiol-disulfide oxidoreductase ResA |
Organism : |
Bacillus cereus (strain ATCC 10987) |
Taxonomy : |
Bacteria |
Subcellular locations : | Cell membrane; |
Length : |
173 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0016021 | Cellular Component | integral to membrane | IEA | GO:0005886 | Cellular Component | plasma membrane | IEA | GO:0016209 | Molecullar Function | antioxidant activity | IEA | GO:0015036 | Molecullar Function | disulfide oxidoreductase activity | IEA | GO:0045454 | Biological Process | cell redox homeostasis | IEA | GO:0017004 | Biological Process | cytochrome complex assembly | IEA | |
Sequences : |
MKKNRLLFRVIILLILSGAVGFTLYQGYFSKEEKMEIGKEAPNFVVTDLEGKKIELKDFKGKGVFLNFWGTWCKPCEKEMPYMNELYPKYKEKGVEIIALDADETDIAVKNFVKQYDLKFPVAIDKGGEIIKTYGVIPLPTSFLIDKDGKVIQEIKGEQTKEQLEEYLKKITP |
Function : | Thiol-disulfide oxidoreductase which is required in disulfide reduction during c-type cytochrome synthesis. May accept reducing equivalents from CcdA, leading to breakage of disulfide bonds in apocytochrome c; following this reduction heme can be covalently attached (By similarity). |