| Q6QPJ6 |
| UniProt ID : |
Q6QPJ6 |
| NCBI Taxonomy : |
640484 |
| Protein names : |
Peroxiredoxin Q, chloroplastic |
| Organism : |
Populus jackii |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Plastid; |
| Length : |
213 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0009534 | Cellular Component | chloroplast thylakoid | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| Sequences : |
MASISLPKHSLPSLLPTLKPITSSSQNLPILSKSSQSQFYGLKFSHSTSLSIPSSSSVKNTIFAKVNKGQAPPSFTLKDQDGKTLSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDDPSSHKAFAKKYRLPFTLLSDEGNKIRKEWGVPADLFGTLPGRQTYVLDKKGVVQLIYNNQFQPEKHIDETLKLLQSL |
| Function : | Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system. Involved in the plant defense against pathogen. |