| Q6PBP3 |
| UniProt ID : |
Q6PBP3 |
| NCBI Taxonomy : |
7955 |
| Protein names : |
Redox-regulatory protein FAM213A |
| Organism : |
Danio rerio |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
212 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | IEA | | GO:0016209 | Molecullar Function | antioxidant activity | IEA | |
| Sequences : |
MGMWSLGLGAVGAAIAGLILANTDFLLTKSAPATVDYLANADLKTIDGDERSLKAKALWEKSGAVIMAVRRPGUFLCREEASELSSLKPQLDELGVPLYAVVKENVGTEIQDFRPHFAGEIFLDEKQAFYGPQQRKMGGLGFIRLGVWQNFVRAWRAGYQGNMNGEGFILGGVFVMGSGGQGVLLEHREKEFGDKVSLESVLEAAKKVVVEK |
| Function : | Involved in redox regulation of the cell. Acts as an antioxidant (By similarity). |