| Q6ER94 |
| UniProt ID : |
Q6ER94 |
| NCBI Taxonomy : |
39947 |
| Protein names : |
2-Cys peroxiredoxin BAS1, chloroplastic |
| Organism : |
Oryza sativa subsp. japonica |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Plastid; |
| Length : |
261 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0048046 | Cellular Component | apoplast | IEA | | GO:0009941 | Cellular Component | chloroplast envelope | IEA | | GO:0009570 | Cellular Component | chloroplast stroma | IEA | | GO:0010319 | Cellular Component | stromule | IEA | | GO:0009579 | Cellular Component | thylakoid | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IDA | | GO:0042742 | Biological Process | defense response to bacterium | IEA | | GO:0042744 | Biological Process | hydrogen peroxide catabolic process | IDA | | GO:0009409 | Biological Process | response to cold | IEA | |
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | Q6ER94 |
| Sequences : |
MAACCSSLATAVSSSSAKPLAGIPPAAPHSLSLPRAPAARPLRLSASSSRSARASSFVARAGGVDDAPLVGNKAPDFDAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYDEFEKLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQDNPDEVCPAGWKPGDKSMKPDPKGSKEYFAAI |
| Function : | Antioxidant enzyme that reduces hydrogen peroxide in chloroplasts. Participates in a NADPH-dependent hydrogen peroxide scavenging system in chloroplasts by receiving reducing equivalents from the thioredoxin reductase NTRC. May be involved in the detoxification of alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system. |