Q6ER94
UniProt ID : Q6ER94
NCBI Taxonomy : 39947
Protein names : 2-Cys peroxiredoxin BAS1, chloroplastic
Organism : Oryza sativa subsp. japonica
Taxonomy : Eukaryota
Subcellular locations :Plastid;
Length : 261
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0048046Cellular ComponentapoplastIEA
GO:0009941Cellular Componentchloroplast envelopeIEA
GO:0009570Cellular Componentchloroplast stromaIEA
GO:0010319Cellular ComponentstromuleIEA
GO:0009579Cellular ComponentthylakoidIEA
GO:0004601Molecullar Functionperoxidase activityIEA
GO:0051920Molecullar Functionperoxiredoxin activityIDA
GO:0042742Biological Processdefense response to bacteriumIEA
GO:0042744Biological Processhydrogen peroxide catabolic processIDA
GO:0009409Biological Processresponse to coldIEA
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :Q6ER94
Sequences : MAACCSSLATAVSSSSAKPLAGIPPAAPHSLSLPRAPAARPLRLSASSSRSARASSFVARAGGVDDAPLVGNKAPDFDAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRYDEFEKLNTEILGVSIDSVFSHLAWVQTDRKSGGLGDLKYPLISDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLAIGRSVDETMRTLQALQYVQDNPDEVCPAGWKPGDKSMKPDPKGSKEYFAAI
Function :Antioxidant enzyme that reduces hydrogen peroxide in chloroplasts. Participates in a NADPH-dependent hydrogen peroxide scavenging system in chloroplasts by receiving reducing equivalents from the thioredoxin reductase NTRC. May be involved in the detoxification of alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system.