| Q6EQG2 |
| UniProt ID : |
Q6EQG2 |
| NCBI Taxonomy : |
39947 |
| Protein names : |
Probable NADH kinase |
| Organism : |
Oryza sativa subsp. japonica |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
325 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005829 | Cellular Component | cytosol | IEA | | GO:0005524 | Molecullar Function | ATP binding | IEA | | GO:0003951 | Molecullar Function | NAD+ kinase activity | IEA | | GO:0042736 | Molecullar Function | NADH kinase activity | IEA | | GO:0019674 | Biological Process | NAD metabolic process | IEA | | GO:0006741 | Biological Process | NADP biosynthetic process | IEA | |
| Catalytic activity : | ATP + NADH = ADP + NADPH. |
| Sequences : |
MALRRVLLFVKPFDVYPPRPLAAAASSPPPPPPPLRVSNPKVLNYLDDRCRVHKETINLCKSVLQRKSIDWISVQRNDMSNPIHDVDLVISVGGDGTLLRASHFLNSSIPVLGVNSDPTCPDEVDELTDEFDARRSTGHLCAATAANFEQILDATLDGSRQPSELSRISVKLNGLQLPTYALNDILVSHPCPASVSRFSFRKRSNTGESSHLINCRSSGLRVATPAGSTAAMLSAGGFVMPISSHELQYMIREPISPRDADKPLLHGLVKQGQHILVVWYNEEGAVYFDGSHVMHSIQHGDTLEISSDAPILKVILPENLLKQGS |
| Function : | Key source of the cellular reductant NADPH which is an important antioxidant factor (By similarity). |