| Q6E2Z6 |
| UniProt ID : |
Q6E2Z6 |
| NCBI Taxonomy : |
3880 |
| Protein names : |
1-Cys peroxiredoxin |
| Organism : |
Medicago truncatula |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Nucleus; |
| Length : |
218 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005634 | Cellular Component | nucleus | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | Q6E2Z6 |
| Sequences : |
MPGLTIGDTIPDLEVDTTQGKIKLHHFCSDSWTILFSHPGDFTPVCTTELGKMAQYASEFNKRGVMLLGMSCDDLESHKEWIKDIEAHTPGAKVNYPIISDPKREIIKQLNMVDPDEKDSNGNLPSRALHIVGPDKKIKLSFLYPAQTGRNMDEVLRVVESLQKASKYKIATPANWKPGEPVVISPDVTNDQAKEMFPQGFKTADLPSKKEYLRFTNV |
| Function : | Antioxidant protein that seems to contribute to the inhibition of germination during stress (By similarity). |