Q6DV14
UniProt ID : Q6DV14
NCBI Taxonomy : 146911
Protein names : Peroxiredoxin-1
Organism : Gecko japonicus
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 199
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005737Cellular ComponentcytoplasmIEA
GO:0004601Molecullar Functionperoxidase activityIEA
GO:0051920Molecullar Functionperoxiredoxin activityIEA
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :Q6DV14
Sequences : MSSGNAYIGKLAPDFQATAVMPDGQFKEIKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSDRSEEFRKINCEVIGASVDSHFCHLAWINTPKKQGGLGSMHIPLVSDTKRVIAKDYGILKEDEGISYRGLFIIDDKGTLRQITINDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWQPGSDTIKPDVQKSKEYFSKHK
Function :Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2) (By similarity). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).