Q6B4U9
UniProt ID : Q6B4U9
NCBI Taxonomy : 59463
Protein names : Peroxiredoxin-1
Organism : Myotis lucifugus
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;Melanosome;
Length : 199
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0042470Cellular ComponentmelanosomeIEA
GO:0005739Cellular ComponentmitochondrionIEA
GO:0005634Cellular ComponentnucleusIEA
GO:0008379Molecullar Functionthioredoxin peroxidase activityIEA
GO:0042744Biological Processhydrogen peroxide catabolic processIEA
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :Q6B4U9
Sequences : MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKINCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK
Function :Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2) (By similarity). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).