Q69TY4
UniProt ID : Q69TY4
NCBI Taxonomy : 39947
Protein names : Peroxiredoxin-2E-1, chloroplastic
Organism : Oryza sativa subsp. japonica
Taxonomy : Eukaryota
Subcellular locations :Plastid;
Length : 232
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0009570Cellular Componentchloroplast stromaIEA
GO:0009505Cellular Componentplant-type cell wallIEA
GO:0009579Cellular ComponentthylakoidIEA
GO:0004601Molecullar Functionperoxidase activityIEA
GO:0051920Molecullar Functionperoxiredoxin activityIEA
GO:0042742Biological Processdefense response to bacteriumIEA
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
Sequences : MAAAASTLASLSATAAAAAGKRLLLSSPSRSLSLSLASRGRIAVMPHLRAGILSAAPRRAVSASAPAAATIAVGDKLPDATLSYFDSPDGELKTVTVRDLTAGKKVVLFAVPGAFTPTCTQKHVPGFVAKAGELRAKGVDAVACVSVNDAFVMRAWKESLGVGDEVLLLSDGNGELARAMGVELDLSDKPAGLGVRSRRYALLAEDGVVKVLNLEEGGAFTTSSAEEMLKAL
Function :Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin or glutaredoxin system. May be involved in chloroplast redox homeostasis (By similarity).