Q63716
UniProt ID : Q63716
NCBI Taxonomy : 10116
Protein names : Peroxiredoxin-1
Organism : Rattus norvegicus
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;Melanosome;
Length : 199
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005829Cellular ComponentcytosolIDA
GO:0042470Cellular ComponentmelanosomeIEA
GO:0005759Cellular Componentmitochondrial matrixIDA
GO:0005719Cellular Componentnuclear euchromatinIDA
GO:0005730Cellular ComponentnucleolusIDA
GO:0005782Cellular Componentperoxisomal matrixIDA
GO:0020037Molecullar Functionheme bindingIPI
GO:0051920Molecullar Functionperoxiredoxin activityIDA
GO:0042803Molecullar Functionprotein homodimerization activityIDA
GO:0008379Molecullar Functionthioredoxin peroxidase activityIEA
GO:0042744Biological Processhydrogen peroxide catabolic processIEA
GO:0006979Biological Processresponse to oxidative stressIDA
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :Q63716
Sequences : MSSGNAKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK
Function :Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).