Q63716 |
UniProt ID : |
Q63716 |
NCBI Taxonomy : |
10116 |
Protein names : |
Peroxiredoxin-1 |
Organism : |
Rattus norvegicus |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm;Melanosome; |
Length : |
199 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005829 | Cellular Component | cytosol | IDA | GO:0042470 | Cellular Component | melanosome | IEA | GO:0005759 | Cellular Component | mitochondrial matrix | IDA | GO:0005719 | Cellular Component | nuclear euchromatin | IDA | GO:0005730 | Cellular Component | nucleolus | IDA | GO:0005782 | Cellular Component | peroxisomal matrix | IDA | GO:0020037 | Molecullar Function | heme binding | IPI | GO:0051920 | Molecullar Function | peroxiredoxin activity | IDA | GO:0042803 | Molecullar Function | protein homodimerization activity | IDA | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | IEA | GO:0042744 | Biological Process | hydrogen peroxide catabolic process | IEA | GO:0006979 | Biological Process | response to oxidative stress | IDA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | Q63716 |
Sequences : |
MSSGNAKIGHPAPSFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWINTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITINDLPVGRSVDEILRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVNKSKEYFSKQK |
Function : | Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity). |