A0R1V9 |
UniProt ID : |
A0R1V9 |
NCBI Taxonomy : |
246196 |
Protein names : |
Alkyl hydroperoxide reductase subunit C |
Organism : |
Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) |
Taxonomy : |
Bacteria |
Length : |
195 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0004601 | Molecullar Function | peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | GO:0006950 | Biological Process | response to stress | IEA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | A0R1V9 |
Sequences : |
MALLTIGDQFPEYDLTAVVGGDLSKVDAKQPDDYFTRVTSKDYEGKWRIIFFWPKDFTFVCPTEIAAFGKLNEDFEDRDAKVLGVSVDNEFVHFQWRAQHEDLKTLPFPMVSDLKRELTAACGVLNADGVADRATFIVDPNNEVQFVSVTAGSVGRNVDEVLRVLDALQSDELCACNWKKGDPTINAGELLAGAV |
Function : | Together with AhpD, DltA and Lpd constitutes an NADH-dependent peroxidase active against hydrogen and alkyl peroxides as well as serving as a peroxynitrite reductase, thus protecting the bacterium against reactive nitrogen intermediates and oxidative stress generated by the host immune system. Does not however seem to play a role in detoxification of isoniazid (By similarity). |