show

Q61171

UniProt ID :

Q61171

NCBI Taxonomy :

10090

Protein names :

Peroxiredoxin-2

Organism :

Mus musculus

Taxonomy :

Eukaryota

Subcellular locations :

Cytoplasm;

Length :

198

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005739	Cellular Component	mitochondrion	IDA
GO:0008430	Molecullar Function	selenium binding	TAS
GO:0008379	Molecullar Function	thioredoxin peroxidase activity	ISS
GO:0000187	Biological Process	activation of MAPK activity	IMP
GO:0048872	Biological Process	homeostasis of number of cells	IMP
GO:0042744	Biological Process	hydrogen peroxide catabolic process	IMP
GO:2001240	Biological Process	negative regulation of extrinsic apoptotic signaling pathway in absence of ligand	IDA
GO:0031665	Biological Process	negative regulation of lipopolysaccharide-mediated signaling pathway	IMP
GO:0032088	Biological Process	negative regulation of NF-kappaB transcription factor activity	IMP
GO:2000378	Biological Process	negative regulation of reactive oxygen species metabolic process	IMP
GO:0045581	Biological Process	negative regulation of T cell differentiation	IMP
GO:0030194	Biological Process	positive regulation of blood coagulation	IMP
GO:0010310	Biological Process	regulation of hydrogen peroxide metabolic process	IMP
GO:0019430	Biological Process	removal of superoxide radicals	IMP
GO:0002536	Biological Process	respiratory burst involved in inflammatory response	IMP
GO:0032496	Biological Process	response to lipopolysaccharide	IMP
GO:0042098	Biological Process	T cell proliferation	IMP
GO:0048538	Biological Process	thymus development	IMP

Catalytic activity :

2 R'-SH + ROOH = R'-S-S-R' + H₂O + ROH.

SWISS-MODEL Repository :

Q61171

Sequences :

MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Function :

Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2).