| Q61171 |
| UniProt ID : |
Q61171 |
| NCBI Taxonomy : |
10090 |
| Protein names : |
Peroxiredoxin-2 |
| Organism : |
Mus musculus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
198 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005739 | Cellular Component | mitochondrion | IDA | | GO:0008430 | Molecullar Function | selenium binding | TAS | | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | ISS | | GO:0000187 | Biological Process | activation of MAPK activity | IMP | | GO:0048872 | Biological Process | homeostasis of number of cells | IMP | | GO:0042744 | Biological Process | hydrogen peroxide catabolic process | IMP | | GO:2001240 | Biological Process | negative regulation of extrinsic apoptotic signaling pathway in absence of ligand | IDA | | GO:0031665 | Biological Process | negative regulation of lipopolysaccharide-mediated signaling pathway | IMP | | GO:0032088 | Biological Process | negative regulation of NF-kappaB transcription factor activity | IMP | | GO:2000378 | Biological Process | negative regulation of reactive oxygen species metabolic process | IMP | | GO:0045581 | Biological Process | negative regulation of T cell differentiation | IMP | | GO:0030194 | Biological Process | positive regulation of blood coagulation | IMP | | GO:0010310 | Biological Process | regulation of hydrogen peroxide metabolic process | IMP | | GO:0019430 | Biological Process | removal of superoxide radicals | IMP | | GO:0002536 | Biological Process | respiratory burst involved in inflammatory response | IMP | | GO:0032496 | Biological Process | response to lipopolysaccharide | IMP | | GO:0042098 | Biological Process | T cell proliferation | IMP | | GO:0048538 | Biological Process | thymus development | IMP | |
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | Q61171 |
| Sequences : |
MASGNAQIGKSAPDFTATAVVDGAFKEIKLSDYRGKYVVLFFYPLDFTFVCPTEIIAFSDHAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTKSLSQNYGVLKNDEGIAYRGLFIIDAKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN |
| Function : | Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). |