Q5ZJF4
UniProt ID : Q5ZJF4
NCBI Taxonomy : 9031
Protein names : Peroxiredoxin-6
Organism : Gallus gallus
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;Lysosome;Cytoplasmic vesicle;
Length : 224
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0016023Cellular Componentcytoplasmic membrane-bounded vesicleIEA
GO:0005764Cellular ComponentlysosomeIEA
GO:0016787Molecullar Functionhydrolase activityIEA
GO:0004601Molecullar Functionperoxidase activityIEA
GO:0051920Molecullar Functionperoxiredoxin activityIEA
GO:0016042Biological Processlipid catabolic processIEA
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :Q5ZJF4
Sequences : MPGLLLGDEAPNFEADTTQGGIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFSKRNVKMIALSIDSVPDHLAWSKDINAYNGDQPVEKLPFPIIADKDRELAVKLGMLDPDERDKDGMPLTARVVFIFGPDKKLKLSILYPATTGRNFDEILRVVDSLQLTAYKKVATPVDWKCGDSVMVVPTLPDEEAKKLFPKGVFTKDLPSGKKYLRYTPQPE
Function :Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury (By similarity).