| Q5ZI34 |
| UniProt ID : |
Q5ZI34 |
| NCBI Taxonomy : |
9031 |
| Protein names : |
Redox-regulatory protein FAM213A |
| Organism : |
Gallus gallus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
224 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | IEA | | GO:0016209 | Molecullar Function | antioxidant activity | IEA | | GO:0055114 | Biological Process | oxidation-reduction process | IEA | | GO:0045670 | Biological Process | regulation of osteoclast differentiation | IEA | |
| Sequences : |
MSFLPDFGIFTMGMWSVGLGAVGAAITGIVLANTDLFLSKPEKATLEFLEAIELKTLGSEPRTFKASELWKKNGAVIMAVRRPGUFLCREEASELSSLKPQLSKLGVPLYAVVKEKIGTEVEDFQHYFQGEIFLDEKRSFYGPRKRKMMLSGFFRIGVWQNFFRAWKNGYSGNLEGEGFTLGGVYVIGAGRQGILLEHREKEFGDKVSLPSVLEAAEKIKPQAS |
| Function : | Involved in redox regulation of the cell. Acts as an antioxidant. Inhibits TNFSF11-induced NFKB1 and JUN activation and osteoclast differentiation. May affect bone resorption and help to maintain bone mass (By similarity). |