Q5RC63
UniProt ID : Q5RC63
NCBI Taxonomy : 9601
Protein names : Peroxiredoxin-2
Organism : Pongo abelii
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 177
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005737Cellular ComponentcytoplasmIEA
GO:0004601Molecullar Functionperoxidase activityIEA
GO:0051920Molecullar Functionperoxiredoxin activityIEA
Catalytic activity :2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.
SWISS-MODEL Repository :Q5RC63
Sequences : MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFHKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEGPCFASP
Function :Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system. It is not able to receive electrons from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2) (By similarity).