| Q5R5F6 |
| UniProt ID : |
Q5R5F6 |
| NCBI Taxonomy : |
9601 |
| Protein names : |
Haptoglobin |
| Organism : |
Pongo abelii |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Secreted; |
| Length : |
347 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005576 | Cellular Component | extracellular region | IEA | | GO:0016209 | Molecullar Function | antioxidant activity | IEA | | GO:0003824 | Molecullar Function | catalytic activity | IEA | | GO:0006953 | Biological Process | acute-phase response | IEA | | GO:0042742 | Biological Process | defense response to bacterium | IEA | | GO:0008152 | Biological Process | metabolic process | IEA | |
| Sequences : |
MSALGAVIALLLWGQLFAVDSGNDVMDISDDGCPKPPQIAHGYVEHSVRYQCKNYYRLRTEGDGVYTLNSEKQWINKAVGDKLPECEAVCGKPKNPANPVQRILGGHLDAKGSFPWQAKMVSRHNLTTGATLINEQWLLTTAKNLFLNHSENATAKDIAPTLTLYVGKKQLVEIEKVVLHPNYSQVDIGLIKLKQKVPVNERVMPICLPSKDYAEVGRVGYVSGWGRNANFKFTEHLKYVMLPVADQDQCVRHYEGSTVPEKKTPKSPVGVQPILNEHTFCAGMSKYQEDTCYGDAGSAFAVHDLEEDTWYAAGILSFDKSCAVAEYGVYVKVTSIQDWVQKTIAKN |
| Function : | As a result of hemolysis, hemoglobin is found to accumulate in the kidney and is secreted in the urine. Haptoglobin captures, and combines with free plasma hemoglobin to allow hepatic recycling of heme iron and to prevent kidney damage. Haptoglobin also acts as an antioxidant, has antibacterial activity and plays a role in modulating many aspects of the acute phase response. Hemoglobin/haptoglobin complexes are rapidely cleared by the macrophage CD163 scavenger receptor expressed on the surface of liver Kupfer cells through an endocytic lysosomal degradation pathway (By similarity). |