Q5NVB2 |
UniProt ID : |
Q5NVB2 |
NCBI Taxonomy : |
9601 |
Protein names : |
Selenoprotein W |
Organism : |
Pongo abelii |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
87 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005737 | Cellular Component | cytoplasm | IEA | GO:0016209 | Molecullar Function | antioxidant activity | IEA | GO:0008430 | Molecullar Function | selenium binding | IEA | GO:0045454 | Biological Process | cell redox homeostasis | IEA | |
SWISS-MODEL Repository : | Q5NVB2 |
Sequences : |
MALAVRVVYCGAUGYKSKYLQLKKKLEDEFPGRLDICGEGTPQATGFFEVMVAGKLIHSKKKGDGYVDTESKFLKLVAAIKAALAQG |
Function : | Plays a role as a glutathione (GSH)-dependent antioxidant. May be involved in a redox-related process. May play a role in the myopathies of selenium deficiency (By similarity). |