| Q54PZ2 |
| UniProt ID : |
Q54PZ2 |
| NCBI Taxonomy : |
44689 |
| Protein names : |
Copper transport protein ATOX1 homolog |
| Organism : |
Dictyostelium discoideum |
| Taxonomy : |
Eukaryota |
| Length : |
67 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0016531 | Molecullar Function | copper chaperone activity | ISS | | GO:0032767 | Molecullar Function | copper-dependent protein binding | ISS | | GO:0006825 | Biological Process | copper ion transport | ISS | |
|
| Sequences : |
MTYSFFVDMTCGGCSKAVNAILSKIDGVSNIQIDLENKKVSCESSKMGADELLKNIQKTGKKCSIIA |
| Function : | Could bind and deliver cytosolic copper to the copper ATPase proteins. May be important in cellular antioxidant defense (By similarity). |