Q54GP3 |
UniProt ID : |
Q54GP3 |
NCBI Taxonomy : |
44689 |
Protein names : |
Sepiapterin reductase |
Organism : |
Dictyostelium discoideum |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
267 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005737 | Cellular Component | cytoplasm | IEA | GO:0004757 | Molecullar Function | sepiapterin reductase activity | ISS | GO:0006979 | Biological Process | response to oxidative stress | IDA | GO:0006729 | Biological Process | tetrahydrobiopterin biosynthetic process | IDA | |
Catalytic activity : | L-erythro-7,8-dihydrobiopterin + NADP+ = sepiapterin + NADPH.L-erythro-tetrahydrobiopterin + 2 NADP+ = 6-pyruvoyl-5,6,7,8-tetrahydropterin + 2 NADPH.Dictyopterin was not identified in one of the enzymatic assays [PubMed:10987137]. |
Sequences : |
MSKVLAIVTGASKGFGKAIAQEIVKCNPNKNQLIDLVLFARSLDGLKSTKESIETISTNAKVIDLQSLDMSNIPDVELKFKSVLENIKWEEYSKICFFNNHGTLYHLGRIEDFSDFKNIQKDNDTNTTSFVVTTSLLVKKLKELGSQYSSEVTIVNSSSLCAIKAFPTWSLYCSSRAYRDMFFQALSLEYKLNDKFKVLNYSLGVLDTDMQSQVREECSEDDKSFYVGLKNDGKLINPNRSASICSNLVYSHKFETGSHLDYYDLDK |
Function : | Catalyzes the production of D-threo-tetrahydrobiopterin (DH4), also known as dictyopterin, and in a much smaller amount that of it's stereoisomer L-erythro-tetrahydrobiopterin (BH4). Prefers 1-oxo-2-D-hydroxypropyl-tetrahydropterin to 6-pyruvoyltetrahydropterin as a substrate, thereby maintaining dominant production of DH4 over BH4 in sufficient supply of an aldose reductase-like enzyme. DH4 represents more than 95% of the total tetrahydrobiopterin production. It has a direct antioxidant function to protect mitochondria against oxidative stress. |