Q54GP3
UniProt ID : Q54GP3
NCBI Taxonomy : 44689
Protein names : Sepiapterin reductase
Organism : Dictyostelium discoideum
Taxonomy : Eukaryota
Subcellular locations :Cytoplasm;
Length : 267
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005737Cellular ComponentcytoplasmIEA
GO:0004757Molecullar Functionsepiapterin reductase activityISS
GO:0006979Biological Processresponse to oxidative stressIDA
GO:0006729Biological Processtetrahydrobiopterin biosynthetic processIDA
Catalytic activity :L-erythro-7,8-dihydrobiopterin + NADP+ = sepiapterin + NADPH.L-erythro-tetrahydrobiopterin + 2 NADP+ = 6-pyruvoyl-5,6,7,8-tetrahydropterin + 2 NADPH.Dictyopterin was not identified in one of the enzymatic assays [PubMed:10987137].
Sequences : MSKVLAIVTGASKGFGKAIAQEIVKCNPNKNQLIDLVLFARSLDGLKSTKESIETISTNAKVIDLQSLDMSNIPDVELKFKSVLENIKWEEYSKICFFNNHGTLYHLGRIEDFSDFKNIQKDNDTNTTSFVVTTSLLVKKLKELGSQYSSEVTIVNSSSLCAIKAFPTWSLYCSSRAYRDMFFQALSLEYKLNDKFKVLNYSLGVLDTDMQSQVREECSEDDKSFYVGLKNDGKLINPNRSASICSNLVYSHKFETGSHLDYYDLDK
Function :Catalyzes the production of D-threo-tetrahydrobiopterin (DH4), also known as dictyopterin, and in a much smaller amount that of it's stereoisomer L-erythro-tetrahydrobiopterin (BH4). Prefers 1-oxo-2-D-hydroxypropyl-tetrahydropterin to 6-pyruvoyltetrahydropterin as a substrate, thereby maintaining dominant production of DH4 over BH4 in sufficient supply of an aldose reductase-like enzyme. DH4 represents more than 95% of the total tetrahydrobiopterin production. It has a direct antioxidant function to protect mitochondria against oxidative stress.