| Q43779 |
| UniProt ID : |
Q43779 |
| NCBI Taxonomy : |
4081 |
| Protein names : |
Superoxide dismutase [Cu-Zn] 2 |
| Organism : |
Solanum lycopersicum |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
152 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005829 | Cellular Component | cytosol | IEA | | GO:0046872 | Molecullar Function | metal ion binding | IEA | | GO:0004784 | Molecullar Function | superoxide dismutase activity | IEA | | GO:0006094 | Biological Process | gluconeogenesis | IEA | | GO:0006096 | Biological Process | glycolysis | IEA | | GO:0046686 | Biological Process | response to cadmium ion | IEA | | GO:0006979 | Biological Process | response to oxidative stress | IEA | | GO:0006801 | Biological Process | superoxide metabolic process | IEA | |
| Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
| SWISS-MODEL Repository : | Q43779 |
| Sequences : |
MVKAVAVLNSSEGVSGTILFTQDGAAPTTVNGNISGLKPGLHGFHVHALGDTTNGCMSTGPHYNPAGKEHGAPEDEVRHAGDLGNITVGEDGTASFTITDKQIPLTGPQSIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRIACGIIGLQG |
| Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. |