Q42564
UniProt ID : Q42564
NCBI Taxonomy : 3702
Protein names : L-ascorbate peroxidase 3, peroxisomal
Organism : Arabidopsis thaliana
Taxonomy : Eukaryota
Subcellular locations :Peroxisome membrane;Glyoxysome membrane;
Length : 287
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0009941Cellular Componentchloroplast envelopeIDA
GO:0046861Cellular Componentglyoxysomal membraneIEA
GO:0009514Cellular ComponentglyoxysomeIEA
GO:0016021Cellular Componentintegral to membraneIEA
GO:0005739Cellular ComponentmitochondrionIDA
GO:0005778Cellular Componentperoxisomal membraneISS
GO:0009506Cellular ComponentplasmodesmaIDA
GO:0005774Cellular Componentvacuolar membraneIDA
GO:0020037Molecullar Functionheme bindingIEA
GO:0016688Molecullar FunctionL-ascorbate peroxidase activityISS
GO:0046872Molecullar Functionmetal ion bindingIEA
GO:0042744Biological Processhydrogen peroxide catabolic processIEA
GO:0006979Biological Processresponse to oxidative stressIMP
Catalytic activity :2 L-ascorbate + H2O2 + 2 H+ = L-ascorbate + L-dehydroascorbate + 2 H2O.
SWISS-MODEL Repository :Q42564
Sequences : MAAPIVDAEYLKEITKARRELRSLIANKNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRNEEEHTHGANSGLKIALDLCEGVKAKHPKITYADLYQLAGVVAVEVTGGPDIVFVPGRKDSNVCPKEGRLPDAKQGFQHLRDVFYRMGLSDKDIVALSGGHTLGRAHPERSGFDGPWTQEPLKFDNSYFVELLKGESEGLLKLPTDKTLLEDPEFRRLVELYAKDEDAFFRDYAESHKKLSELGFNPNSSAGKAVADSTILAQSAFGVAVAAAVVAFGYFYEIRKRMK
Function :Plays a key role in hydrogen peroxide removal (By similarity).