| Q42564 |
| UniProt ID : |
Q42564 |
| NCBI Taxonomy : |
3702 |
| Protein names : |
L-ascorbate peroxidase 3, peroxisomal |
| Organism : |
Arabidopsis thaliana |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Peroxisome membrane;Glyoxysome membrane; |
| Length : |
287 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0009941 | Cellular Component | chloroplast envelope | IDA | | GO:0046861 | Cellular Component | glyoxysomal membrane | IEA | | GO:0009514 | Cellular Component | glyoxysome | IEA | | GO:0016021 | Cellular Component | integral to membrane | IEA | | GO:0005739 | Cellular Component | mitochondrion | IDA | | GO:0005778 | Cellular Component | peroxisomal membrane | ISS | | GO:0009506 | Cellular Component | plasmodesma | IDA | | GO:0005774 | Cellular Component | vacuolar membrane | IDA | | GO:0020037 | Molecullar Function | heme binding | IEA | | GO:0016688 | Molecullar Function | L-ascorbate peroxidase activity | ISS | | GO:0046872 | Molecullar Function | metal ion binding | IEA | | GO:0042744 | Biological Process | hydrogen peroxide catabolic process | IEA | | GO:0006979 | Biological Process | response to oxidative stress | IMP | |
| Catalytic activity : | 2 L-ascorbate + H2O2 + 2 H+ = L-ascorbate + L-dehydroascorbate + 2 H2O. |
| SWISS-MODEL Repository : | Q42564 |
| Sequences : |
MAAPIVDAEYLKEITKARRELRSLIANKNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRNEEEHTHGANSGLKIALDLCEGVKAKHPKITYADLYQLAGVVAVEVTGGPDIVFVPGRKDSNVCPKEGRLPDAKQGFQHLRDVFYRMGLSDKDIVALSGGHTLGRAHPERSGFDGPWTQEPLKFDNSYFVELLKGESEGLLKLPTDKTLLEDPEFRRLVELYAKDEDAFFRDYAESHKKLSELGFNPNSSAGKAVADSTILAQSAFGVAVAAAVVAFGYFYEIRKRMK |
| Function : | Plays a key role in hydrogen peroxide removal (By similarity). |