Q42564 |
UniProt ID : |
Q42564 |
NCBI Taxonomy : |
3702 |
Protein names : |
L-ascorbate peroxidase 3, peroxisomal |
Organism : |
Arabidopsis thaliana |
Taxonomy : |
Eukaryota |
Subcellular locations : | Peroxisome membrane;Glyoxysome membrane; |
Length : |
287 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0009941 | Cellular Component | chloroplast envelope | IDA | GO:0046861 | Cellular Component | glyoxysomal membrane | IEA | GO:0009514 | Cellular Component | glyoxysome | IEA | GO:0016021 | Cellular Component | integral to membrane | IEA | GO:0005739 | Cellular Component | mitochondrion | IDA | GO:0005778 | Cellular Component | peroxisomal membrane | ISS | GO:0009506 | Cellular Component | plasmodesma | IDA | GO:0005774 | Cellular Component | vacuolar membrane | IDA | GO:0020037 | Molecullar Function | heme binding | IEA | GO:0016688 | Molecullar Function | L-ascorbate peroxidase activity | ISS | GO:0046872 | Molecullar Function | metal ion binding | IEA | GO:0042744 | Biological Process | hydrogen peroxide catabolic process | IEA | GO:0006979 | Biological Process | response to oxidative stress | IMP | |
Catalytic activity : | 2 L-ascorbate + H2O2 + 2 H+ = L-ascorbate + L-dehydroascorbate + 2 H2O. |
SWISS-MODEL Repository : | Q42564 |
Sequences : |
MAAPIVDAEYLKEITKARRELRSLIANKNCAPIMLRLAWHDAGTYDAQSKTGGPNGSIRNEEEHTHGANSGLKIALDLCEGVKAKHPKITYADLYQLAGVVAVEVTGGPDIVFVPGRKDSNVCPKEGRLPDAKQGFQHLRDVFYRMGLSDKDIVALSGGHTLGRAHPERSGFDGPWTQEPLKFDNSYFVELLKGESEGLLKLPTDKTLLEDPEFRRLVELYAKDEDAFFRDYAESHKKLSELGFNPNSSAGKAVADSTILAQSAFGVAVAAAVVAFGYFYEIRKRMK |
Function : | Plays a key role in hydrogen peroxide removal (By similarity). |