| Q2KIK2 |
| UniProt ID : |
Q2KIK2 |
| NCBI Taxonomy : |
9913 |
| Protein names : |
Mpv17-like protein |
| Organism : |
Bos taurus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Peroxisome membrane; |
| Length : |
196 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0016021 | Cellular Component | integral to membrane | IEA | | GO:0005778 | Cellular Component | peroxisomal membrane | IEA | |
|
| Sequences : |
MVSWWQALTRAAGRYPWPANVLLYAGFFSGGDALQQVLRGGPADWQHTRHVATVAVAFHANLNYVWLNLLERALPGRAPRTILAKVLCDQALGGPVYVSTFYAGMSILQGKDDIFLDMRQKFWNTYKSGLMYWPFVQLINFSLIPIRWRTAYTGLCGFLWATFLCFSQQEGDGTFKSAFTFRRIKVTNEVEKPSEK |
| Function : | Participates in reactive oxygen species metablism by up- or down-regulation of the genes of antioxidant enzymes (By similarity). |