Q2G282
UniProt ID : Q2G282
NCBI Taxonomy : 93061
Protein names : Peroxide-responsive repressor PerR
Organism : Staphylococcus aureus (strain NCTC 8325)
Taxonomy : Bacteria
Subcellular locations :Cytoplasm;
Length : 148
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005737Cellular ComponentcytoplasmIEA
GO:0003677Molecullar FunctionDNA bindingIEA
GO:0046872Molecullar Functionmetal ion bindingIEA
GO:0003700Molecullar Functionsequence-specific DNA binding transcription factor activityIEA
GO:0006351Biological Processtranscription, DNA-dependentIEA
SWISS-MODEL Repository :Q2G282
Sequences : MSVEIESIEHELEESIASLRQAGVRITPQRQAILRYLISSHTHPTADEIYQALSPDFPNISVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQHMTDFDVTHHRMEIYGVCKECQDK
Function :Manganese-dependent repressor that controls a regulon of oxidative stress resistance and iron-storage proteins. Regulates expression of genes encoding antioxidant proteins, such as katA, ahpCF, bcp and trxB. Also regulates expression of the iron-storage protein ftn, the ferritin-like protein mrgA, the ferric uptake regulator fur, the manganese transporter operon mntABC, and its own expression. May act as a hydrogen peroxide and organic hydroperoxide sensor. Required for full virulence in a murine skin abscess model of infection.