| Q2G282 |
| UniProt ID : |
Q2G282 |
| NCBI Taxonomy : |
93061 |
| Protein names : |
Peroxide-responsive repressor PerR |
| Organism : |
Staphylococcus aureus (strain NCTC 8325) |
| Taxonomy : |
Bacteria |
| Subcellular locations : | Cytoplasm; |
| Length : |
148 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | IEA | | GO:0003677 | Molecullar Function | DNA binding | IEA | | GO:0046872 | Molecullar Function | metal ion binding | IEA | | GO:0003700 | Molecullar Function | sequence-specific DNA binding transcription factor activity | IEA | | GO:0006351 | Biological Process | transcription, DNA-dependent | IEA | |
| SWISS-MODEL Repository : | Q2G282 |
| Sequences : |
MSVEIESIEHELEESIASLRQAGVRITPQRQAILRYLISSHTHPTADEIYQALSPDFPNISVATIYNNLRVFKDIGIVKELTYGDSSSRFDFNTHNHYHIICEQCGKIVDFQYPQLNEIERLAQHMTDFDVTHHRMEIYGVCKECQDK |
| Function : | Manganese-dependent repressor that controls a regulon of oxidative stress resistance and iron-storage proteins. Regulates expression of genes encoding antioxidant proteins, such as katA, ahpCF, bcp and trxB. Also regulates expression of the iron-storage protein ftn, the ferritin-like protein mrgA, the ferric uptake regulator fur, the manganese transporter operon mntABC, and its own expression. May act as a hydrogen peroxide and organic hydroperoxide sensor. Required for full virulence in a murine skin abscess model of infection. |