show

Q28502

UniProt ID :

Q28502

NCBI Taxonomy :

9544

Protein names :

Apolipoprotein E

Organism :

Macaca mulatta

Taxonomy :

Eukaryota

Subcellular locations :

Secreted;

Length :

107

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0042627	Cellular Component	chylomicron	IEA
GO:0034364	Cellular Component	high-density lipoprotein particle	IEA
GO:0034363	Cellular Component	intermediate-density lipoprotein particle	IEA
GO:0034361	Cellular Component	very-low-density lipoprotein particle	IEA
GO:0016209	Molecullar Function	antioxidant activity	IEA
GO:0001540	Molecullar Function	beta-amyloid binding	IEA
GO:0008201	Molecullar Function	heparin binding	IEA
GO:0008289	Molecullar Function	lipid binding	IEA
GO:0005319	Molecullar Function	lipid transporter activity	IEA
GO:0046911	Molecullar Function	metal chelating activity	IEA
GO:0019934	Biological Process	cGMP-mediated signaling	IEA
GO:0008203	Biological Process	cholesterol metabolic process	IEA
GO:0034382	Biological Process	chylomicron remnant clearance	IEA
GO:0007186	Biological Process	G-protein coupled receptor signaling pathway	IEA
GO:0034380	Biological Process	high-density lipoprotein particle assembly	IEA
GO:0034384	Biological Process	high-density lipoprotein particle clearance	IEA
GO:0034375	Biological Process	high-density lipoprotein particle remodeling	IEA
GO:0042157	Biological Process	lipoprotein metabolic process	IEA
GO:0034374	Biological Process	low-density lipoprotein particle remodeling	IEA
GO:0043537	Biological Process	negative regulation of blood vessel endothelial cell migration	IEA
GO:0045541	Biological Process	negative regulation of cholesterol biosynthetic process	IEA
GO:0001937	Biological Process	negative regulation of endothelial cell proliferation	IEA
GO:0050728	Biological Process	negative regulation of inflammatory response	IEA
GO:0043407	Biological Process	negative regulation of MAP kinase activity	IEA
GO:0010544	Biological Process	negative regulation of platelet activation	IEA
GO:0007263	Biological Process	nitric oxide mediated signal transduction	IEA
GO:0033700	Biological Process	phospholipid efflux	IEA
GO:0030828	Biological Process	positive regulation of cGMP biosynthetic process	IEA
GO:0010875	Biological Process	positive regulation of cholesterol efflux	IEA
GO:0032805	Biological Process	positive regulation of low-density lipoprotein particle receptor catabolic process	IEA
GO:0051044	Biological Process	positive regulation of membrane protein ectodomain proteolysis	IEA
GO:0051000	Biological Process	positive regulation of nitric-oxide synthase activity	IEA
GO:0006898	Biological Process	receptor-mediated endocytosis	IEA
GO:0032489	Biological Process	regulation of Cdc42 protein signal transduction	IEA
GO:0043691	Biological Process	reverse cholesterol transport	IEA
GO:0006641	Biological Process	triglyceride metabolic process	IEA
GO:0034447	Biological Process	very-low-density lipoprotein particle clearance	IEA

SWISS-MODEL Repository :

Q28502

Sequences :

LSPQVTQELTTLMDETMKELKAYKSELEEQLSPVAEETRARLSKELQAAQARLGADMEDVRSRLVQYRSEVQAMLGQSTEELRARLASHLRKLRKRLLRDADDLQKR

Function :

Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.