| Q13162 |
| UniProt ID : |
Q13162 |
| NCBI Taxonomy : |
9606 |
| Protein names : |
Peroxiredoxin-4 |
| Organism : |
Homo sapiens |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm;Secreted; |
| Length : |
271 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005615 | Cellular Component | extracellular space | IEA | | GO:0005739 | Cellular Component | mitochondrion | IEA | | GO:0008379 | Molecullar Function | thioredoxin peroxidase activity | TAS | | GO:0007252 | Biological Process | I-kappaB phosphorylation | TAS | | GO:0072593 | Biological Process | reactive oxygen species metabolic process | IEA | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | Q13162 |
| Sequences : |
MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN |
| Function : | Probably involved in redox regulation of the cell. Regulates the activation of NF-kappa-B in the cytosol by a modulation of I-kappa-B-alpha phosphorylation. |