Q0D840 |
UniProt ID : |
Q0D840 |
NCBI Taxonomy : |
39947 |
Protein names : |
Thioredoxin H1 |
Organism : |
Oryza sativa subsp. japonica |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm; |
Length : |
122 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005737 | Cellular Component | cytoplasm | IEA | GO:0009055 | Molecullar Function | electron carrier activity | IEA | GO:0004857 | Molecullar Function | enzyme inhibitor activity | IDA | GO:0016671 | Molecullar Function | oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor | IDA | GO:0015035 | Molecullar Function | protein disulfide oxidoreductase activity | IEA | GO:0045454 | Biological Process | cell redox homeostasis | IEA | GO:0006662 | Biological Process | glycerol ether metabolic process | IEA | GO:0010497 | Biological Process | plasmodesmata-mediated intercellular transport | IDA | GO:0009409 | Biological Process | response to cold | IEP | GO:0006979 | Biological Process | response to oxidative stress | IEP | |
SWISS-MODEL Repository : | Q0D840 |
Sequences : |
MAAEEGVVIACHNKDEFDAQMTKAKEAGKVVIIDFTASWCGPCRFIAPVFAEYAKKFPGAVFLKVDVDELKEVAEKYNVEAMPTFLFIKDGAEADKVVGARKDDLQNTIVKHVGATAASASA |
Function : | Thiol-disulfide oxidoreductase involved in the redox regulation of MAP kinases. Under reducing conditions, inhibits MPK1 and MPK5 kinase activities. Mediates its own transport from cell-to-cell through plasmodesmata. Possesses insulin disulfide bonds reducing activity. |