Q0AKM4 |
UniProt ID : |
Q0AKM4 |
NCBI Taxonomy : |
394221 |
Protein names : |
Alkyl hydroperoxide reductase AhpD |
Organism : |
Maricaulis maris (strain MCS10) |
Taxonomy : |
Bacteria |
Length : |
173 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0008785 | Molecullar Function | alkyl hydroperoxide reductase activity | IEA | GO:0032843 | Molecullar Function | hydroperoxide reductase activity | IEA | GO:0004601 | Molecullar Function | peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | GO:0006979 | Biological Process | response to oxidative stress | IEA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | Q0AKM4 |
Sequences : |
MSIDALKNELPEYAKDLKLNLSSLGRETELDDQKKWGTFLASAHAVGEPKTLAAIKAEAETRLSDEALTAAKAASAIMGMNNVYYRFVHLSKNKEYATLPAKLRMNILANPGVDKADFELWSLAVSAINGCGLCIDSHEAELRKHGLTTTQVQAAVRIAATVNAIAAVLAAES |
Function : | Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity (By similarity). |