| B1MJX0 |
| UniProt ID : |
B1MJX0 |
| NCBI Taxonomy : |
561007 |
| Protein names : |
Alkyl hydroperoxide reductase AhpD |
| Organism : |
Mycobacterium abscessus (strain ATCC 19977 / DSM 44196) |
| Taxonomy : |
Bacteria |
| Length : |
175 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0008785 | Molecullar Function | alkyl hydroperoxide reductase activity | IEA | | GO:0032843 | Molecullar Function | hydroperoxide reductase activity | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | | GO:0006979 | Biological Process | response to oxidative stress | IEA | |
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | B1MJX0 |
| Sequences : |
MSIENLKEALPEYAKDLKLNLGTVARGTVLSQSQLWGTLVATAAATRNEQVFKEIREEAAGILTPEALDAALGAASIMAMTNVFYRGRGFLDGAYDDLRPGLRMNIIGNPGVDKSEFELWSFAVSTINGCHYCVGSHEKVLREAGLTREQVLEALKIAAIVAGVAQALATVPALV |
| Function : | Antioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity (By similarity). |