show

Q06830

UniProt ID :

Q06830

NCBI Taxonomy :

9606

Protein names :

Peroxiredoxin-1

Organism :

Homo sapiens

Taxonomy :

Eukaryota

Subcellular locations :

Cytoplasm;Melanosome;

Length :

199

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005829	Cellular Component	cytosol	IEA
GO:0042470	Cellular Component	melanosome	IEA
GO:0005759	Cellular Component	mitochondrial matrix	IEA
GO:0005739	Cellular Component	mitochondrion	IDA
GO:0005719	Cellular Component	nuclear euchromatin	IEA
GO:0005730	Cellular Component	nucleolus	IEA
GO:0005634	Cellular Component	nucleus	IDA
GO:0005782	Cellular Component	peroxisomal matrix	IEA
GO:0020037	Molecullar Function	heme binding	IEA
GO:0008379	Molecullar Function	thioredoxin peroxidase activity	IDA
GO:0008283	Biological Process	cell proliferation	TAS
GO:0034101	Biological Process	erythrocyte homeostasis	IEA
GO:0042744	Biological Process	hydrogen peroxide catabolic process	IDA
GO:0042267	Biological Process	natural killer cell mediated cytotoxicity	IEA
GO:0042345	Biological Process	regulation of NF-kappaB import into nucleus	IEA
GO:0032872	Biological Process	regulation of stress-activated MAPK cascade	IEA
GO:0019430	Biological Process	removal of superoxide radicals	IEA
GO:0001501	Biological Process	skeletal system development	TAS

Catalytic activity :

2 R'-SH + ROOH = R'-S-S-R' + H₂O + ROH.

SWISS-MODEL Repository :

Q06830

Sequences :

MSSGNAKIGHPAPNFKATAVMPDGQFKDISLSDYKGKYVVFFFYPLDFTFVCPTEIIAFSDRAEEFKKLNCQVIGASVDSHFCHLAWVNTPKKQGGLGPMNIPLVSDPKRTIAQDYGVLKADEGISFRGLFIIDDKGILRQITVNDLPVGRSVDETLRLVQAFQFTDKHGEVCPAGWKPGSDTIKPDVQKSKEYFSKQK

Function :

Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).