Q00637 |
UniProt ID : |
Q00637 |
NCBI Taxonomy : |
7227 |
Protein names : |
Superoxide dismutase [Mn], mitochondrial |
Organism : |
Drosophila melanogaster |
Taxonomy : |
Eukaryota |
Subcellular locations : | Mitochondrion matrix; |
Length : |
217 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005759 | Cellular Component | mitochondrial matrix | IEA | GO:0016209 | Molecullar Function | antioxidant activity | NAS | GO:0046872 | Molecullar Function | metal ion binding | IEA | GO:0004784 | Molecullar Function | superoxide dismutase activity | IEA | GO:0008340 | Biological Process | determination of adult lifespan | IMP | GO:0035206 | Biological Process | regulation of hemocyte proliferation | IMP | GO:0019222 | Biological Process | regulation of metabolic process | IMP | GO:0006801 | Biological Process | superoxide metabolic process | IEA | |
Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
SWISS-MODEL Repository : | Q00637 |
Sequences : |
MFVARKISPNCKPGVRGKHTLPKLPYDYAALEPIICREIMELHHQKHHQTYVNNLNAAEEQLEEAKSKSDTTKLIQLAPALRFNGGGHINHTIFWQNLSPNKTQPSDDLKKAIESQWKSLEEFKKELTTLTVAVQGSGWGWLGFNKKSGKLQLAALPNQDPLEASTGLIPLFGIDVWEHAYYLQYKNVRPSYVEAIWDIANWDDISCRFQEAKKLGC |
Function : | Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems. |