show

P99999

UniProt ID :

P99999

NCBI Taxonomy :

9606

Protein names :

Cytochrome c

Organism :

Homo sapiens

Taxonomy :

Eukaryota

Subcellular locations :

Mitochondrion intermembrane space;

Length :

105

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005829	Cellular Component	cytosol	IMP
GO:0005743	Cellular Component	mitochondrial inner membrane	TAS
GO:0005758	Cellular Component	mitochondrial intermembrane space	TAS
GO:0005634	Cellular Component	nucleus	IDA
GO:0000159	Cellular Component	protein phosphatase type 2A complex	TAS
GO:0070469	Cellular Component	respiratory chain	IEA
GO:0045155	Molecullar Function	electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity	IDA
GO:0020037	Molecullar Function	heme binding	TAS
GO:0005506	Molecullar Function	iron ion binding	IEA
GO:0008635	Biological Process	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	TAS
GO:0006309	Biological Process	apoptotic DNA fragmentation	IMP
GO:0097193	Biological Process	intrinsic apoptotic signaling pathway	TAS
GO:0022904	Biological Process	respiratory electron transport chain	TAS
GO:0044281	Biological Process	small molecule metabolic process	TAS

SWISS-MODEL Repository :

P99999

Sequences :

MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Function :

Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.