| P99029 |
| UniProt ID : |
P99029 |
| NCBI Taxonomy : |
10090 |
| Protein names : |
Peroxiredoxin-5, mitochondrial |
| Organism : |
Mus musculus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Mitochondrion;Cytoplasm;Peroxisome; |
| Length : |
210 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0031410 | Cellular Component | cytoplasmic vesicle | IEA | | GO:0005829 | Cellular Component | cytosol | IEA | | GO:0005739 | Cellular Component | mitochondrion | IDA | | GO:0005634 | Cellular Component | nucleus | IEA | | GO:0048471 | Cellular Component | perinuclear region of cytoplasm | IEA | | GO:0005782 | Cellular Component | peroxisomal matrix | ISS | | GO:0016209 | Molecullar Function | antioxidant activity | ISS | | GO:0043027 | Molecullar Function | cysteine-type endopeptidase inhibitor activity involved in apoptotic process | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0072541 | Molecullar Function | peroxynitrite reductase activity | IEA | | GO:0005102 | Molecullar Function | receptor binding | ISS | | GO:0001016 | Molecullar Function | RNA polymerase III regulatory region DNA binding | IEA | | GO:0042744 | Biological Process | hydrogen peroxide catabolic process | ISS | | GO:0070995 | Biological Process | NADPH oxidation | IEA | | GO:0043066 | Biological Process | negative regulation of apoptotic process | IEA | | GO:0051354 | Biological Process | negative regulation of oxidoreductase activity | IEA | | GO:0016480 | Biological Process | negative regulation of transcription from RNA polymerase III promoter | IEA | | GO:0032967 | Biological Process | positive regulation of collagen biosynthetic process | IEA | | GO:2001057 | Biological Process | reactive nitrogen species metabolic process | IEA | | GO:0060785 | Biological Process | regulation of apoptosis involved in tissue homeostasis | IEA | |
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | P99029 |
| Sequences : |
MLQLGLRVLGCKASSVLRASTCLAGRAGRKEAGWECGGARSFSSSAVTMAPIKVGDAIPSVEVFEGEPGKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFVIEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKALNVEPDGTGLTCSLAPNILSQL |
| Function : | Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system. Involved in intracellular redox signaling. |