show

P99029

UniProt ID :

P99029

NCBI Taxonomy :

10090

Protein names :

Peroxiredoxin-5, mitochondrial

Organism :

Mus musculus

Taxonomy :

Eukaryota

Subcellular locations :

Mitochondrion;Cytoplasm;Peroxisome;

Length :

210

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0031410	Cellular Component	cytoplasmic vesicle	IEA
GO:0005829	Cellular Component	cytosol	IEA
GO:0005739	Cellular Component	mitochondrion	IDA
GO:0005634	Cellular Component	nucleus	IEA
GO:0048471	Cellular Component	perinuclear region of cytoplasm	IEA
GO:0005782	Cellular Component	peroxisomal matrix	ISS
GO:0016209	Molecullar Function	antioxidant activity	ISS
GO:0043027	Molecullar Function	cysteine-type endopeptidase inhibitor activity involved in apoptotic process	IEA
GO:0004601	Molecullar Function	peroxidase activity	IEA
GO:0072541	Molecullar Function	peroxynitrite reductase activity	IEA
GO:0005102	Molecullar Function	receptor binding	ISS
GO:0001016	Molecullar Function	RNA polymerase III regulatory region DNA binding	IEA
GO:0042744	Biological Process	hydrogen peroxide catabolic process	ISS
GO:0070995	Biological Process	NADPH oxidation	IEA
GO:0043066	Biological Process	negative regulation of apoptotic process	IEA
GO:0051354	Biological Process	negative regulation of oxidoreductase activity	IEA
GO:0016480	Biological Process	negative regulation of transcription from RNA polymerase III promoter	IEA
GO:0032967	Biological Process	positive regulation of collagen biosynthetic process	IEA
GO:2001057	Biological Process	reactive nitrogen species metabolic process	IEA
GO:0060785	Biological Process	regulation of apoptosis involved in tissue homeostasis	IEA

Catalytic activity :

2 R'-SH + ROOH = R'-S-S-R' + H₂O + ROH.

SWISS-MODEL Repository :

P99029

Sequences :

MLQLGLRVLGCKASSVLRASTCLAGRAGRKEAGWECGGARSFSSSAVTMAPIKVGDAIPSVEVFEGEPGKKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAGALKAKGAQVVACLSVNDVFVIEEWGRAHQAEGKVRLLADPTGAFGKATDLLLDDSLVSLFGNRRLKRFSMVIDNGIVKALNVEPDGTGLTCSLAPNILSQL

Function :

Reduces hydrogen peroxide and alkyl hydroperoxides with reducing equivalents provided through the thioredoxin system. Involved in intracellular redox signaling.