| P97532 |
| UniProt ID : |
P97532 |
| NCBI Taxonomy : |
10116 |
| Protein names : |
3-mercaptopyruvate sulfurtransferase |
| Organism : |
Rattus norvegicus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm;Mitochondrion;Cell junction; |
| Length : |
297 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0030054 | Cellular Component | cell junction | IEA | | GO:0005739 | Cellular Component | mitochondrion | IDA | | GO:0043005 | Cellular Component | neuron projection | ISS | | GO:0045202 | Cellular Component | synapse | IEA | | GO:0016784 | Molecullar Function | 3-mercaptopyruvate sulfurtransferase activity | IEA | | GO:0004792 | Molecullar Function | thiosulfate sulfurtransferase activity | IEA | | GO:0070814 | Biological Process | hydrogen sulfide biosynthetic process | ISS | |
| Catalytic activity : | 3-mercaptopyruvate + cyanide = pyruvate + thiocyanate. |
| SWISS-MODEL Repository : | P97532 |
| Sequences : |
MAAPQLFRALVSAQWVAEALKSPRASQPLKLLDASWYLPKLGRDARREFEERHIPGAAFFDIDRCSDHTSPYDHMLPSATHFADYAGSLGVSAATHVVIYDGSDQGLYSAPRVWWMFRAFGHHSVSLLDGGFRYWLSQNLPISSGKSPSEPAEFCAQLDPSFIKTHEDILENLDARRFQVVDARAAGRFQGTQPEPRDGIEPGHIPGSVNIPFTEFLTSEGLEKSPEEIQRLFQEKKVDLSKPLVATCGSGVTACHVVLGAFLCGKPDVPVYDGSWVEWYMRAQPEHVISQGRGKTL |
| Function : | Transfer of a sulfur ion to cyanide or to other thiol compounds. Also has weak rhodanese activity. Detoxifies cyanide and is required for thiosulfate biosynthesis. Acts as an antioxidant. In combination with cysteine aminotransferase (CAT), contributes to the catabolism of cysteine and is an important producer of hydrogen sulfide in the brain, retina and vascular endothelial cells. Hydrogen sulfide H(2)S is an important synaptic modulator, signaling molecule, smooth muscle contractor and neuroprotectant. Its production by the 3MST/CAT pathway is regulated by calcium ions. |