P95855 |
UniProt ID : |
P95855 |
NCBI Taxonomy : |
273057 |
Protein names : |
DNA protection during starvation protein |
Organism : |
Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) |
Taxonomy : |
Archaea |
Subcellular locations : | Cytoplasm; |
Length : |
188 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005737 | Cellular Component | cytoplasm | IEA | GO:0009295 | Cellular Component | nucleoid | IEA | GO:0008199 | Molecullar Function | ferric iron binding | IEA | GO:0016491 | Molecullar Function | oxidoreductase activity | IEA | GO:0006879 | Biological Process | cellular iron ion homeostasis | IEA | |
Catalytic activity : | 2 Fe(2+) + H2O2 + 2 H+ = 2 Fe3+ + 2 H2O. |
SWISS-MODEL Repository : | P95855 |
Sequences : |
MQEKPQEPKVVGVEILEKSGLDIKKLVDKLVKATAAEFTTYYYYTILRMHLTGMEGEGLKEIAEDARLEDRLHFELMTQRIYELGGGLPRDIRQLADISACSDAYLPENWKDPKEILKVLLEAEQCAIRTWKEVCDMTYGKDPRTYDLAQRILQEEIEHEAWFLELLYGRPSGHFRRSSPGNAPYSKK |
Function : | Protects DNA from oxidative damage by sequestering intracellular Fe(2+) ion and storing it in the form of Fe(3+) oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe(2+) ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity). In vitro, it efficiently oxidizes Fe(2+) in the presence of hydrogen peroxide and stores it as a mineral core. |