P95855
UniProt ID : P95855
NCBI Taxonomy : 273057
Protein names : DNA protection during starvation protein
Organism : Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2)
Taxonomy : Archaea
Subcellular locations :Cytoplasm;
Length : 188
Gene Ontology :
GO IDOntologyDefinitionEvidence
GO:0005737Cellular ComponentcytoplasmIEA
GO:0009295Cellular ComponentnucleoidIEA
GO:0008199Molecullar Functionferric iron bindingIEA
GO:0016491Molecullar Functionoxidoreductase activityIEA
GO:0006879Biological Processcellular iron ion homeostasisIEA
Catalytic activity :2 Fe(2+) + H2O2 + 2 H+ = 2 Fe3+ + 2 H2O.
SWISS-MODEL Repository :P95855
Sequences : MQEKPQEPKVVGVEILEKSGLDIKKLVDKLVKATAAEFTTYYYYTILRMHLTGMEGEGLKEIAEDARLEDRLHFELMTQRIYELGGGLPRDIRQLADISACSDAYLPENWKDPKEILKVLLEAEQCAIRTWKEVCDMTYGKDPRTYDLAQRILQEEIEHEAWFLELLYGRPSGHFRRSSPGNAPYSKK
Function :Protects DNA from oxidative damage by sequestering intracellular Fe(2+) ion and storing it in the form of Fe(3+) oxyhydroxide mineral. One hydrogen peroxide oxidizes two Fe(2+) ions, which prevents hydroxyl radical production by the Fenton reaction (By similarity). In vitro, it efficiently oxidizes Fe(2+) in the presence of hydrogen peroxide and stores it as a mineral core.