| P91938 |
| UniProt ID : |
P91938 |
| NCBI Taxonomy : |
7227 |
| Protein names : |
Thioredoxin reductase 1, mitochondrial |
| Organism : |
Drosophila melanogaster |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Mitochondrion;Cytoplasm; |
| Length : |
596 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005875 | Cellular Component | microtubule associated complex | IDA | | GO:0005739 | Cellular Component | mitochondrion | IDA | | GO:0050660 | Molecullar Function | flavin adenine dinucleotide binding | IEA | | GO:0004362 | Molecullar Function | glutathione-disulfide reductase activity | IMP | | GO:0050661 | Molecullar Function | NADP binding | IEA | | GO:0042803 | Molecullar Function | protein homodimerization activity | IDA | | GO:0004791 | Molecullar Function | thioredoxin-disulfide reductase activity | IDA | | GO:0045454 | Biological Process | cell redox homeostasis | IMP | | GO:0008340 | Biological Process | determination of adult lifespan | IMP | | GO:0022008 | Biological Process | neurogenesis | IMP | | GO:0006974 | Biological Process | response to DNA damage stimulus | IMP | | GO:0001666 | Biological Process | response to hypoxia | IMP | |
| Catalytic activity : | Thioredoxin + NADP+ = thioredoxin disulfide + NADPH.Binds 1 FAD per subunit. |
| SWISS-MODEL Repository : | P91938 |
| Sequences : |
MNLCNSRFSVTFVRQCSTILTSPSAGIIQNRGSLTTKVPHWISSSLSCAHHTFQRTMNLTGQRGSRDSTGATGGNAPAGSGAGAPPPFQHPHCDRAAMYAQPVRKMSTKGGSYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDEKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEEAEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTPASCCS |
| Function : | Thioredoxin system is a major player in glutathione metabolism, due to the demonstrated absence of a glutathione reductase. Functionally interacts with the Sod/Cat reactive oxidation species (ROS) defense system and thereby has a role in preadult development and life span. Lack of a glutathione reductase suggests antioxidant defense in Drosophila, and probably in related insects, differs fundamentally from that in other organisms. |