show

P91938

UniProt ID :

P91938

NCBI Taxonomy :

7227

Protein names :

Thioredoxin reductase 1, mitochondrial

Organism :

Drosophila melanogaster

Taxonomy :

Eukaryota

Subcellular locations :

Mitochondrion;Cytoplasm;

Length :

596

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0005875	Cellular Component	microtubule associated complex	IDA
GO:0005739	Cellular Component	mitochondrion	IDA
GO:0050660	Molecullar Function	flavin adenine dinucleotide binding	IEA
GO:0004362	Molecullar Function	glutathione-disulfide reductase activity	IMP
GO:0050661	Molecullar Function	NADP binding	IEA
GO:0042803	Molecullar Function	protein homodimerization activity	IDA
GO:0004791	Molecullar Function	thioredoxin-disulfide reductase activity	IDA
GO:0045454	Biological Process	cell redox homeostasis	IMP
GO:0008340	Biological Process	determination of adult lifespan	IMP
GO:0022008	Biological Process	neurogenesis	IMP
GO:0006974	Biological Process	response to DNA damage stimulus	IMP
GO:0001666	Biological Process	response to hypoxia	IMP

Catalytic activity :

Thioredoxin + NADP⁺ = thioredoxin disulfide + NADPH.Binds 1 FAD per subunit.

SWISS-MODEL Repository :

P91938

Sequences :

MNLCNSRFSVTFVRQCSTILTSPSAGIIQNRGSLTTKVPHWISSSLSCAHHTFQRTMNLTGQRGSRDSTGATGGNAPAGSGAGAPPPFQHPHCDRAAMYAQPVRKMSTKGGSYDYDLIVIGGGSAGLACAKEAVLNGARVACLDFVKPTPTLGTKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNVDEKIKPDWHKLVQSVQNHIKSVNWVTRVDLRDKKVEYINGLGSFVDSHTLLAKLKSGERTITAQTFVIAVGGRPRYPDIPGAVEYGITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPTVMVRSIVLRGFDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGKLLVKYKNVETGEEAEDVYDTVLWAIGRKGLVDDLNLPNAGVTVQKDKIPVDSQEATNVANIYAVGDIIYGKPELTPVAVLAGRLLARRLYGGSTQRMDYKDVATTVFTPLEYACVGLSEEDAVKQFGADEIEVFHGYYKPTEFFIPQKSVRYCYLKAVAERHGDQRVYGLHYIGPVAGEVIQGFAAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSGLDPTPASCCS

Function :

Thioredoxin system is a major player in glutathione metabolism, due to the demonstrated absence of a glutathione reductase. Functionally interacts with the Sod/Cat reactive oxidation species (ROS) defense system and thereby has a role in preadult development and life span. Lack of a glutathione reductase suggests antioxidant defense in Drosophila, and probably in related insects, differs fundamentally from that in other organisms.