| P91883 |
| UniProt ID : |
P91883 |
| NCBI Taxonomy : |
6192 |
| Protein names : |
Thioredoxin peroxidase |
| Organism : |
Fasciola hepatica |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm; |
| Length : |
194 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | P91883 |
| Sequences : |
MLQPNMPAPNFSGQAVVGKEFETISLSDYKGKWVILAFYPLDFTFVCPTEIIAISDQMEQFAQRNCAVIFCSTDSVYSHLQWTKMDRKVGGIGQLNFPLLADKNMSVSRAFGVLDEEQGNTYRGNFLIDPKGVLRQITVNDDPVGRSVEEALRLLDAFIFHEEHGEVCPANWKPKSKTIVPTPDGSKAYFSSAN |
| Function : | Antioxidant. Could be involved in protection against reactive oxygen species (ROS) generated by metabolic processes and/or protection of the parasite against ROS released by immune effector cells. |