| B0M2T2 |
| UniProt ID : |
B0M2T2 |
| NCBI Taxonomy : |
68455 |
| Protein names : |
Hemoglobin subunit alpha |
| Organism : |
Crocodylus siamensis |
| Taxonomy : |
Eukaryota |
| Length : |
141 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005833 | Cellular Component | hemoglobin complex | IEA | | GO:0020037 | Molecullar Function | heme binding | IEA | | GO:0005506 | Molecullar Function | iron ion binding | IEA | | GO:0019825 | Molecullar Function | oxygen binding | IEA | | GO:0005344 | Molecullar Function | oxygen transporter activity | IEA | |
| Sequences : |
VLSSDDKCNVKAVWCKVAGHLEEYGAEALERMFCAYPQTKIYFPHFDLSHGSAQIRAHGKKVFAALHEAVNHIDDLPGALCRLSELHAHSLRVDPVNFKFLAQCVLVVVAIHHPGSLTPEVHASLDKFLCAVSSVLTSKYR |
| Function : | Involved in oxygen transport from the lung to the various peripheral tissues. Has antimicrobial activity against B.subtilis ATCC 6633. Has antioxidant activity. |