B0M2T2 |
UniProt ID : |
B0M2T2 |
NCBI Taxonomy : |
68455 |
Protein names : |
Hemoglobin subunit alpha |
Organism : |
Crocodylus siamensis |
Taxonomy : |
Eukaryota |
Length : |
141 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005833 | Cellular Component | hemoglobin complex | IEA | GO:0020037 | Molecullar Function | heme binding | IEA | GO:0005506 | Molecullar Function | iron ion binding | IEA | GO:0019825 | Molecullar Function | oxygen binding | IEA | GO:0005344 | Molecullar Function | oxygen transporter activity | IEA | |
Sequences : |
VLSSDDKCNVKAVWCKVAGHLEEYGAEALERMFCAYPQTKIYFPHFDLSHGSAQIRAHGKKVFAALHEAVNHIDDLPGALCRLSELHAHSLRVDPVNFKFLAQCVLVVVAIHHPGSLTPEVHASLDKFLCAVSSVLTSKYR |
Function : | Involved in oxygen transport from the lung to the various peripheral tissues. Has antimicrobial activity against B.subtilis ATCC 6633. Has antioxidant activity. |