| P86215 |
| UniProt ID : |
P86215 |
| NCBI Taxonomy : |
10036 |
| Protein names : |
Peroxiredoxin-6 |
| Organism : |
Mesocricetus auratus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm;Lysosome;Cytoplasmic vesicle; |
| Length : |
50 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005737 | Cellular Component | cytoplasm | ISS | | GO:0016023 | Cellular Component | cytoplasmic membrane-bounded vesicle | IEA | | GO:0005764 | Cellular Component | lysosome | IEA | | GO:0004602 | Molecullar Function | glutathione peroxidase activity | IEA | | GO:0016787 | Molecullar Function | hydrolase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | | GO:0016042 | Biological Process | lipid catabolic process | IEA | |
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH.2 glutathione + H2O2 = glutathione disulfide + 2 H2O. |
| Sequences : |
DFTPVCTTELGRLAPEFAKRVVFIFGPDKKLKLSILYPATTGRNFDEILR |
| Function : | Involved in redox regulation of the cell. Can reduce H(2)O(2) and short chain organic, fatty acid, and phospholipid hydroperoxides. May play a role in the regulation of phospholipid turnover as well as in protection against oxidative injury (By similarity). |