show

P85278

UniProt ID :

P85278

NCBI Taxonomy :

136217

Protein names :

Turmerin

Organism :

Curcuma longa

Taxonomy :

Eukaryota

Length :

Gene Ontology :

GO ID	Ontology	Definition	Evidence
GO:0016209	Molecullar Function	antioxidant activity	IEA
GO:0004867	Molecullar Function	serine-type endopeptidase inhibitor activity	IEA
GO:0050832	Biological Process	defense response to fungus	IEA
GO:0031640	Biological Process	killing of cells of other organism	IEA

Sequences :

LCPLDVLQLSSELLDIDGNEVEASRILSDITAFGGIRCPLTVVQSRGIGTIISSPYRFIAEGHPLSLKDMDGWFRVSDDEFNNYK

Function :

Inhibition of trypsin (By similarity). Has anticarcinogenic activity, prevents transformation of DMBA-treated JB6 cells. Has antipromoter activity, prevents promotion by tetradecanoyl phorbal acetate (TPA) in JB6 cells. Prevents tertiary butyl hydroperoxide-induced mutagenesis. Protects AT base pairs and shows antimutagenesis activity in TA102 and TA104 S.typhimurium mutagenesis tests. Inhibits paw edema formation induced by phospholipase A2 in Swiss Wistar mice. Prevents the release of arachidonate, the parent compound for the synthesis of prostaglandins and prostacyclins. Has antimalarial activity, kills P.falciparum. Has antivenom activity, nullifies the lethal effects of N.naja venom and inhibits phospholipase A2 present in N.naja venom. Has antifungal activity, inhibits cilia formation by A.niger. Is not toxic or allergenic.