| P84729 |
| UniProt ID : |
P84729 |
| NCBI Taxonomy : |
3348 |
| Protein names : |
Putative 2-Cys peroxiredoxin BAS1 |
| Organism : |
Pinus strobus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Plastid; |
| Length : |
56 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0009507 | Cellular Component | chloroplast | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | |
|
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| Sequences : |
GLFIIDKEGVIQHSTINNEGVIQHSTINNLAIGRFGVLLADQGLALRSIPNGPSAL |
| Function : | May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf (By similarity). |