| P81269 |
| UniProt ID : |
P81269 |
| NCBI Taxonomy : |
10090 |
| Protein names : |
Cyclic AMP-dependent transcription factor ATF-1 |
| Organism : |
Mus musculus |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Nucleus; |
| Length : |
269 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005634 | Cellular Component | nucleus | ISO | | GO:0005667 | Cellular Component | transcription factor complex | IDA | | GO:0003677 | Molecullar Function | DNA binding | IDA | | GO:0043565 | Molecullar Function | sequence-specific DNA binding | IEA | | GO:0003700 | Molecullar Function | sequence-specific DNA binding transcription factor activity | IEA | | GO:0006351 | Biological Process | transcription, DNA-dependent | IEA | |
| SWISS-MODEL Repository : | P81269 |
| Sequences : |
MEDSHKSNTTETASQPGSTVAGPHVSQIVHQVSSLSESEESQDSSDSIGSSQKAHGILARRPSYRKILKDLSSEDTRGRKGEGENPSISAITSMSVPAPIYQTSSGQYIAIAPNGALQLASPSTDGVQALQTLTMTNSSSTQQGTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLASQTTKTDDPQLRREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSHKSV |
| Function : | Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), a sequence present in many viral and cellular promoters. Binds to the Tax-responsive element (TRE) of HTLV-I. Mediates PKA-induced stimulation of CRE-reporter genes. Represses the expression of FTH1 and other antioxidant detoxification genes. Triggers cell proliferation and transformation (By similarity). |