| P80740 |
| UniProt ID : |
P80740 |
| NCBI Taxonomy : |
4146 |
| Protein names : |
Superoxide dismutase [Cu-Zn] 1 |
| Organism : |
Olea europaea |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Cytoplasm;Endoplasmic reticulum; |
| Length : |
30 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0005783 | Cellular Component | endoplasmic reticulum | IEA | | GO:0046872 | Molecullar Function | metal ion binding | IEA | | GO:0004784 | Molecullar Function | superoxide dismutase activity | IEA | |
|
| Catalytic activity : | 2 superoxide + 2 H+ = O2 + H2O2. |
| Sequences : |
MVKAVTVLNSSEGPHGIVYFAQEGDGPTTV |
| Function : | Destroys radicals which are normally produced within the cells and which are toxic to biological systems. Probably involved in the protection against oxidative stress during pollen development. |