P80602 |
UniProt ID : |
P80602 |
NCBI Taxonomy : |
4565 |
Protein names : |
2-Cys peroxiredoxin BAS1, chloroplastic |
Organism : |
Triticum aestivum |
Taxonomy : |
Eukaryota |
Subcellular locations : | Plastid; |
Length : |
210 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0009507 | Cellular Component | chloroplast | IEA | GO:0004601 | Molecullar Function | peroxidase activity | IEA | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | |
Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
SWISS-MODEL Repository : | P80602 |
Sequences : |
DARARSFVARAAAEYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHEEFEKINTEILGVSVDSVFSHLAWVQTERKSGGLGDLKYPLVSDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETLRTLRALQYVKKPDEVCPAGWKPGEKSMKPDPKGSKEYFAAI |
Function : | May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. |