| P80602 |
| UniProt ID : |
P80602 |
| NCBI Taxonomy : |
4565 |
| Protein names : |
2-Cys peroxiredoxin BAS1, chloroplastic |
| Organism : |
Triticum aestivum |
| Taxonomy : |
Eukaryota |
| Subcellular locations : | Plastid; |
| Length : |
210 |
| Gene Ontology : | | GO ID | Ontology | Definition | Evidence | | GO:0009507 | Cellular Component | chloroplast | IEA | | GO:0004601 | Molecullar Function | peroxidase activity | IEA | | GO:0051920 | Molecullar Function | peroxiredoxin activity | IEA | |
| Catalytic activity : | 2 R'-SH + ROOH = R'-S-S-R' + H2O + ROH. |
| SWISS-MODEL Repository : | P80602 |
| Sequences : |
DARARSFVARAAAEYDLPLVGNKAPDFAAEAVFDQEFINVKLSDYIGKKYVILFFYPLDFTFVCPTEITAFSDRHEEFEKINTEILGVSVDSVFSHLAWVQTERKSGGLGDLKYPLVSDVTKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETLRTLRALQYVKKPDEVCPAGWKPGEKSMKPDPKGSKEYFAAI |
| Function : | May be an antioxidant enzyme particularly in the developing shoot and photosynthesizing leaf. |