P70195 |
UniProt ID : |
P70195 |
NCBI Taxonomy : |
10090 |
Protein names : |
Proteasome subunit beta type-7 |
Organism : |
Mus musculus |
Taxonomy : |
Eukaryota |
Subcellular locations : | Cytoplasm;Nucleus; |
Length : |
277 |
Gene Ontology : | GO ID | Ontology | Definition | Evidence | GO:0005829 | Cellular Component | cytosol | TAS | GO:0005634 | Cellular Component | nucleus | IEA | GO:0005839 | Cellular Component | proteasome core complex | IDA | GO:0004298 | Molecullar Function | threonine-type endopeptidase activity | IEA | GO:0051603 | Biological Process | proteolysis involved in cellular protein catabolic process | IEA | |
Catalytic activity : | Cleavage of peptide bonds with very broad specificity. |
SWISS-MODEL Repository : | P70195 |
Sequences : |
MAAVSVFQPPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGADTRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVVTANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAVFEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPFSVPNKKGTRLGRYRCEKGTTAVLTEKVTPLEIEVLEETVQTMDTS |
Function : | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This unit is responsible of the trypsin-like activity of the proteasome (By similarity). |